PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.K03262.1.p
Common NameEUGRSUZ_K03262, LOC104426573
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family MYB
Protein Properties Length: 261aa    MW: 29193.6 Da    PI: 6.5078
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.K03262.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.14.1e-181461148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g+WT++Ed +l+++v+ +G g+W++ ++  g+ R++k+c++rw +yl
  Eucgr.K03262.1.p 14 KGPWTPDEDRILINYVQHHGHGNWRRLPKLAGLLRCGKSCRLRWTNYL 61
                      79******************************99************97 PP

2Myb_DNA-binding50.93.6e-1667112148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       rg+++ eE++ +++++++lG++ W++Ia++++ gRt++++k+ w+++l
  Eucgr.K03262.1.p  67 RGNFSREEEDTIIQLHEMLGNR-WSAIAARLP-GRTDNEIKNVWHTHL 112
                       89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.8E-26564IPR009057Homeodomain-like
PROSITE profilePS5129418.611961IPR017930Myb domain
SuperFamilySSF466893.07E-3110108IPR009057Homeodomain-like
SMARTSM007171.2E-141363IPR001005SANT/Myb domain
PfamPF002491.1E-161461IPR001005SANT/Myb domain
CDDcd001674.11E-111661No hitNo description
PROSITE profilePS5129425.29262116IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.9E-2665116IPR009057Homeodomain-like
SMARTSM007171.3E-1466114IPR001005SANT/Myb domain
PfamPF002492.4E-1567112IPR001005SANT/Myb domain
CDDcd001675.00E-1069112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 261 aa     Download sequence    Send to blast
MGRAPCCEKM GLKKGPWTPD EDRILINYVQ HHGHGNWRRL PKLAGLLRCG KSCRLRWTNY  60
LRPDIKRGNF SREEEDTIIQ LHEMLGNRWS AIAARLPGRT DNEIKNVWHT HLKKRLRKEH  120
EAAVLDNVPS KRLVTMSHTN NEPHAKYESH GGPISSPQTQ QSSSSVSLSS TTTEDNSGND  180
NKCIKEALED AISGLIDENF WSELVSSDDN NSAMSDDFLA VSSEFQSSLS SNVGPWDMNG  240
GGMVDCFWYD LLKGAELADV *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-26121165108B-MYB
1h8a_C4e-261211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.K03262.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010037978.10.0PREDICTED: myb-related protein Myb4
TrEMBLA0A059A8S80.0A0A059A8S8_EUCGR; Uncharacterized protein
STRINGPOPTR_0002s03960.18e-86(Populus trichocarpa)
STRINGPOPTR_0005s24550.19e-86(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G31180.17e-75myb domain protein 14